DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:219 Identity:115/219 - (52%)
Similarity:126/219 - (57%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYRFS 65
            ||.|.|.|||..|||.......|||         ...|.|||.|..|.|  ..||.||||||.:|
  Fly     1 MAAKIVIALALFAVAHGAVLRTAAP---------VAVASAPVPVLAKTV--ELEEVDPHPQYTYS 54

  Fly    66 YGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAVA 130
            |.|.|.|:|||||.||||||||||||||||||||:||.|.||||.||||||||.||||...||..
  Fly    55 YDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAE 119

  Fly   131 PVVKTV-----AAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTV-----------APVA 179
            |::|..     |||||..|..|:   ||||.:...|||| .||| ::|:.           ||:|
  Fly   120 PLLKVAAPLVKAAPVAPIAPVAL---AAPAPIVRSAPVA-VAAP-LIKSAPLAVAAPFVRSAPLA 179

  Fly   180 HYAAPAAY---ATYAAPTHYAAPA 200
             .||||..   |.||.|..|.|||
  Fly   180 -VAAPAPVLRTAAYATPLRYTAPA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 40/51 (78%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 40/51 (78%)

Return to query results.
Submit another query.