DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Ccp84Af

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:183 Identity:110/183 - (60%)
Similarity:123/183 - (67%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAV--AQKVVVKAAEEYDPHPQYR 63
            |||||...||.::.||||..|:  .|||||||||||||.|||||  ||.|:.||.|||||||||:
  Fly     1 MAFKFFAVLALISAASAGVLPV--QQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYK 63

  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVA 128
            |:|.|.|.|:||:|.||||||||||.|||||||:||||||||||:||:|||||||||.||     
  Fly    64 FAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPL----- 123

  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHY 181
              ..|||                    |||||||||..|||      .|||::
  Fly   124 --DHVKT--------------------VVKTVAPVAVAAAP------IPVAYH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 39/51 (76%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440136
Domainoid 1 1.000 46 1.000 Domainoid score I19263
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 1 1.000 - - otm50847
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4906
109.850

Return to query results.
Submit another query.