DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:225 Identity:114/225 - (50%)
Similarity:133/225 - (59%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKF--VFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYR 63
            |||||  :|| |.:||||||..|.|||.               .||||      .|||||||||.
  Fly     1 MAFKFTILFA-ACIAVASAGIIPAAAPL---------------AAVAQ------VEEYDPHPQYT 43

  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVA 128
            :.|.|.|.::||:|.|||.|:||||:|:|||.|||||:|||.|||||||||||||.|||||.|||
  Fly    44 YGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVA 108

  Fly   129 V---------APVVK-TVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAA 183
            .         ||||: .|||||.: |||....|||     ..||:|:.|||      ||:| |||
  Fly   109 AAPAAVVAAPAPVVRAAVAAPVVR-AAPLTTTYAA-----APAPLAYAAAP------APLA-YAA 160

  Fly   184 PAAYATYAAP----------THYAAPAVAY 203
            ||. ...|||          |.:|:|.::|
  Fly   161 PAP-VVKAAPLVAAGPAIVKTQFASPLISY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 34/51 (67%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.