DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Edg84A

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster


Alignment Length:159 Identity:72/159 - (45%)
Similarity:90/159 - (56%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVV 118
            :.||.||||.|:|.|.|..|||.|.|.|.||||||.|:||:.|||||:|.|.||||.:.||||||
  Fly    29 DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVV 93

  Fly   119 NREPL------VKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAP 177
            .||||      ||..|.|.|.|....|:.:..|......|:..|.::.|||.|:|      .|..
  Fly    94 RREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVHHA------PVTH 152

  Fly   178 VAHYAAPA-AYATYAAPTHYAAPAVAYHP 205
            |.|:|||| ::.::..|........|:||
  Fly   153 VVHHAAPAHSFVSHHVPVLKTTVHHAHHP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 31/51 (61%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440154
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.