DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:144 Identity:63/144 - (43%)
Similarity:81/144 - (56%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALAFVAVASAGYA-------PIAAPQVYHAAPAV-ATYAHAPVA---------VAQKVVVKAA-- 53
            :||.:..:.:||:       |:.| ..|..||:| |..:|||||         |.|..|:|..  
  Fly  1081 SLAHLDSSLSGYSHGVGGIGPLGA-GFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPE 1144

  Fly    54 ---EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFN 115
               |.:|.||:|.|.|.|:|..|||||.|.||||||||:|||||::.||..|.|:|.||...||:
  Fly  1145 KHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFH 1209

  Fly   116 A-VVNREPLVKAVA 128
            | |:|.....|.||
  Fly  1210 AEVINSRDQGKIVA 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 31/51 (61%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.