DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:170 Identity:45/170 - (26%)
Similarity:64/170 - (37%) Gaps:39/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IAAPQVYHAAP----AVATYAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEE 82
            :.:|.:.:..|    .::.|.|                .|.|.||  :||....|.  :|.:...
  Fly    17 VGSPTLEYGPPPTSDTISQYHH----------------QDEHGQY--AYGYMAPLY--SKHETRT 61

  Fly    83 RDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPA 147
            .|| |:||.:|.|||:|..:.|.|.|| ..||: |.:..|..:|....|.|          ||..
  Fly    62 VDG-VIRGTFSHIDANGETQTVDYVAD-AEGFH-VTSNLPNQQANQETPEV----------AALR 113

  Fly   148 VAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY 187
            ..|..|....|......:...|..|:....||  ||..|:
  Fly   114 TQHLEAHNQAKLRLAGDYSVGPQPVRDTPEVA--AAKVAF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 19/51 (37%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.