DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:214 Identity:98/214 - (45%)
Similarity:118/214 - (55%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVFAL-AFVAVASAGYAP---IAAPQVYHAAPAVATYAHAPVAVAQKVVVKAA--EEYDPH 59
            ||.|.:..| |.|||:||...|   :|.| .|.:.||:|       .||..:|.|.|  |.|||:
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALP-AYPSYPALA-------KVAAPLVAKVAGPEPYDPN 57

  Fly    60 PQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLV 124
            |||.|||.|.|..|||.|.|.|.|.||||:|.||||:|||.:|||:|||||::||||||.||   
  Fly    58 PQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE--- 119

  Fly   125 KAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYAT 189
                 ..|||.| ||||:..|||...:|:|.|.|..|     ..||:......:||...||....
  Fly   120 -----GAVVKAV-APVAKVLAPAPLLHASPLVAKVPA-----YGPALAPAYPALAHGYGPALAPA 173

  Fly   190 YA-APTHYAAPAVA---YH 204
            |. |....|.||::   ||
  Fly   174 YGPALPKLALPALSPLGYH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 33/51 (65%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50625
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.