DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and Cpr35B

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:137 Identity:57/137 - (41%)
Similarity:69/137 - (50%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAEE---------- 55
            ||.||..|.|.:|:|:...||....: :|.....|| :||.|.:...  ....||          
  Fly     1 MAQKFFIAFALLAIAAIRAAPFHGHE-HHGHHGGAT-SHASVHLTSH--DDHHEEHHGHHHDHHG 61

  Fly    56 ----YDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNA 116
                :|.|.:|.|.|||.|:.|||.|.|.|.|.|..|.|.|.||||||:||.|.||||...||.|
  Fly    62 HDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEA 126

  Fly   117 VVNREPL 123
            .|:||.|
  Fly   127 HVHREKL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453214
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.