DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and LOC1277180

DIOPT Version :10

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_316624.4 Gene:LOC1277180 / 1277180 VectorBaseID:AGAMI1_000285 Length:193 Species:Anopheles gambiae


Alignment Length:66 Identity:37/66 - (56%)
Similarity:48/66 - (72%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVN 119
            :|..||.|:|.|||.|..|||:|.|.|.||||||:|.|:|.:|||.:|:|:||:|..:||.|.|.
Mosquito    93 DYYSHPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYTSDKHHGFQAHVK 157

  Fly   120 R 120
            |
Mosquito   158 R 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)
LOC1277180XP_316624.4 None

Return to query results.
Submit another query.