DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1rl and flz

DIOPT Version :9

Sequence 1:NP_001002804.2 Gene:C1rl / 408246 RGDID:1302936 Length:488 Species:Rattus norvegicus
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:325 Identity:82/325 - (25%)
Similarity:127/325 - (39%) Gaps:58/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat   192 PGPYYKE-EQTGTLSC---PSSRKWKDRQRGEEVPECV-----PVCGRPVVPIAENPNTFGSSRA 247
            |.|...| :|..|||.   .:.||.....|....|...     ..||  |.|..::....|...:
  Fly  1393 PNPSDNEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECG--VRPHVKSGRIVGGKGS 1455

  Rat   248 KPGNFPWQA----------FTSIYGRGGGALLGDRWILTAAHTIFPKDSIYLRKNKTVNVFLGHT 302
            ..|.:|||.          ||.  .:.||.|:..|:::||||.    ...:|.....|   :|..
  Fly  1456 TFGAYPWQVLVRESTWLGLFTK--NKCGGVLITSRYVITAAHC----QPGFLASLVAV---MGEF 1511

  Rat   303 DVD---ELLKLGNHPVRRVVVHPDYRQEESHNFDGDIALLELEHRVPLGPSLLPVCLPDNETLYH 364
            |:.   |..:.....|:||:||   ||.:...|:.|:|||||:..|.....::|:|:| |:....
  Fly  1512 DISGDLESKRSVTKNVKRVIVH---RQYDPATFENDLALLELDSPVQFDTHIVPICMP-NDVADF 1572

  Rat   365 SGLWGYISGFGVEMGWLTTKLKYS----------KLPVAPREACEAWLRQRQRTEVFSDNMFCVG 419
            :|....::|:|        :|||.          ::|:.....|:.........:....:..|.|
  Fly  1573 TGRMATVTGWG--------RLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAG 1629

  Rat   420 EEMQVNSVCQGDSGSVYVVWDDRALRWVATGIVSWGVGCGKGY--GFYTKVLSYVDWIKGVIECK 482
            ........|:||||...|:..... |:...|.||.|:.|...|  |.|.:...|..|::.:...|
  Fly  1630 YANGQKDSCEGDSGGPLVLQRPDG-RYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSITGVK 1693

  Rat   483  482
              Fly  1694  1693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1rlNP_001002804.2 CUB 55..164 CDD:238001
Tryp_SPc 243..476 CDD:238113 66/257 (26%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 66/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.