DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcpt8l2 and CG18420

DIOPT Version :9

Sequence 1:NP_001128482.1 Gene:Mcpt8l2 / 408240 RGDID:1302938 Length:248 Species:Rattus norvegicus
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:114/253 - (45%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    18 GGEIIWGTESKPHSRPYMAFIKFYDSNSEPQSCGGFLVAKDIVMTAAHC--NGRNIKVTLGAHNI 80
            |..|:.|..:..:|.|:|||:   .::|....|||.|:::.:|:|||||  ....|.|.||.:| 
  Fly    40 GPRIVNGKVAVRNSSPWMAFL---HTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYN- 100

  Rat    81 RK----RENTQVISVVKAKPHENYDKHSRFNDIMLLKLERKAQLNGAVKTIALPRSQDW---VKP 138
            ||    ||..||....:   |..||.::..|||.||:|.........::.|.:.....|   :..
  Fly   101 RKLKGYREEHQVNRTFQ---HRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDS 162

  Rat   139 GQVCTVAGWGHLANCTSSNTLQEVNLEVQKGQKC--------QDMSKDYNDSIQLCVGNPKEGKA 195
            .:|.|..|||...:...|:.|:.:::..|..:.|        |..:.::|.:  ||:|       
  Fly   163 IKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVLSNQFCAGNWNSN--LCIG------- 218

  Rat   196 TSERDSGGP------------FVCDGVAQGIVS-RCLCTGTLPRVFTRISSFIPWIQK 240
                |:|||            ||..|:|  |.: ||    ..|.|||.:.|.|.:|::
  Fly   219 ----DTGGPVGAMVRYRNAFRFVQVGIA--ITNKRC----QRPSVFTDVMSHIEFIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcpt8l2NP_001128482.1 Tryp_SPc 20..238 CDD:214473 71/247 (29%)
Tryp_SPc 21..241 CDD:238113 72/250 (29%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 71/247 (29%)
Tryp_SPc 43..267 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.