DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ab and Cpr92F

DIOPT Version :9

Sequence 1:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:279 Identity:74/279 - (26%)
Similarity:95/279 - (34%) Gaps:94/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVFALAFVAVASAGYAPIAAPQVYHAAPAVAT-YAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGV 68
            |:.|...::..||.         :|.  ||:| |.|                .||| .:.:|||.
  Fly     5 FIAAALLISTVSAS---------WHG--AVSTQYQH----------------LDPH-SHTYSYGY 41

  Fly    69 DDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPVV 133
            .|  ....|.:....|| ...|.||.:|..|:.::|.|||||.:|||||....|....|..|||.
  Fly    42 AD--PNSQKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVY 103

  Fly   134 KTVAA--PVAQYA-----APAVAHYAAPAVVKTV--APVAHYAAPAV------------------ 171
            ....|  ..|.||     .|.:.|...|.....|  |..||.||.|.                  
  Fly   104 AAAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGG 168

  Fly   172 ------------------VKT----VAPVAHYAAPAAYATYAAPTH----------YAAPAHYAA 204
                              |.|    .|...||||.|....:.|..|          :|..||:||
  Fly   169 GWAYGQAAHVPLTHGGVPVDTPDVQAAKAEHYAAHAKALGHVAHAHGAPVETPEVQHAKAAHFAA 233

  Fly   205 PAATYTSYSAPAV---AYH 220
            .||..:.::...:   .||
  Fly   234 HAAARSGHAVSPINHGGYH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 18/51 (35%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.