DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ab and Cpr92A

DIOPT Version :9

Sequence 1:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:252 Identity:102/252 - (40%)
Similarity:118/252 - (46%) Gaps:58/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVASAGYAPIAAPQVYHAAPA-------VATYA--HAPVA---VAQKVVVKAAEEYDPHPQYRFS 65
            |:....||.:..|..|:..||       ...||  |.|:.   ||.|..  |.|.|||.|:|.|.
  Fly     9 AMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPA--APEPYDPDPKYSFG 71

  Fly    66 YGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLV-KAVA- 128
            |.:.|..|||.|.|.|.|.||||:|.||::|.||.||||.|||||.:||||||.:|||. ||.| 
  Fly    72 YDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAH 136

  Fly   129 VAPVVKTVAAPVAQYAAPAVA---------------------HYAAPAVVKTVAPVAHYAAPA-- 170
            :||||....|||..:..||.|                     |..|||.....||.   .|||  
  Fly   137 LAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPAPA---PAPAPV 198

  Fly   171 ---VVKTVAPVAHY--AAPA-AYATYAAPTHYAAPAHYAAPAATYTSYSAPAVAYHH 221
               |...|.|.||:  |.|| |::.||   ||.||....||.       .|...|||
  Fly   199 SVPVATPVLPSAHFHAAYPALAHSPYA---HYPAPGPAPAPV-------EPHAYYHH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 20/57 (35%)
Chitin_bind_4 68..120 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.