DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ab and Ccp84Ad

DIOPT Version :9

Sequence 1:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:223 Identity:171/223 - (76%)
Similarity:181/223 - (81%) Gaps:26/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAV--AQKVVVKAAEEYDPHPQYR 63
            |||||:...|.:|.||||..|:  .|||||||||||||.|||||  ||.|:.||||||||||||:
  Fly     1 MAFKFIALFALIAAASAGVLPV--QQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYK 63

  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVA 128
            ::|.|.|.|:||:|.||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    64 YAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVA 128

  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYATYAAP 193
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||         
  Fly   129 VAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAP--------- 184

  Fly   194 THYAAPAHYAAPAATYTSYSAPAVAYHH 221
                         ||||||:||||||||
  Fly   185 -------------ATYTSYAAPAVAYHH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 42/51 (82%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440132
Domainoid 1 1.000 46 1.000 Domainoid score I19263
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 1 1.050 193 1.000 Inparanoid score I6289
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 1 1.000 - - otm50847
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4906
1110.900

Return to query results.
Submit another query.