DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ab and CG13670

DIOPT Version :9

Sequence 1:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:112 Identity:40/112 - (35%)
Similarity:55/112 - (49%) Gaps:23/112 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVASAGYA------PIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGVDDK 71
            |.|:.||:      |:..|:            |.......:.|     :|...|:|.|:|||:|.
  Fly    65 ACAAVGYSYARFEGPVVGPE------------HLVTVHDGRTV-----DYVARPEYSFAYGVEDG 112

  Fly    72 LTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV 118
            .|...:.:.|.|:||.|||.||::|.||..|.|:||||..|||.|.|
  Fly   113 KTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 26/51 (51%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 26/51 (51%)
Paf1 <215..265 CDD:281915
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.