DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ab and Cpr30B

DIOPT Version :10

Sequence 1:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:148 Identity:58/148 - (39%)
Similarity:75/148 - (50%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPIN 112
            :.::|..:|.| ..|.|.:.|:|..|||.|.|.|.|..|.|.|.|.|||:|||:|.|||.||..|
  Fly    20 IELQAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHN 83

  Fly   113 GFNAVVNREPL-VKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAP-AVVKTV 175
            ||.|:|.|||. :|.....|..|.:||.:.....|             |||:.||||| |::|..
  Fly    84 GFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVLP-------------VAPLVHYAAPKAIIKQE 135

  Fly   176 APVAHY---AAPAAYATY 190
            ....:|   :.|.|...|
  Fly   136 LSAGNYVSVSGPTAQYKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 28/51 (55%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.