DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ab and Cpr5C

DIOPT Version :9

Sequence 1:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:150 Identity:103/150 - (68%)
Similarity:115/150 - (76%) Gaps:13/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATY-AHAPVA----VAQKVVVKAAEEYDPHP 60
            ||||||..||.:|.||||..|  |.|:||||| |||| |.||.|    |||.|:.||.|||||||
  Fly     1 MAFKFVALLALIAAASAGVLP--AGQLYHAAP-VATYAAPAPAAVLKTVAQPVLAKADEEYDPHP 62

  Fly    61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVK 125
            ||:::|.|.|.::||:|.||||||||||||||||:|:||:|||||||||||||||||||||||||
  Fly    63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK 127

  Fly   126 AVAVAPVVKTVAAPVAQYAA 145
            .     ||||||.....|||
  Fly   128 T-----VVKTVAPVAPVYAA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 38/51 (75%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440138
Domainoid 1 1.000 46 1.000 Domainoid score I19263
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 1 1.000 - - otm50847
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.