DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and CG34461

DIOPT Version :10

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster


Alignment Length:144 Identity:62/144 - (43%)
Similarity:80/144 - (55%) Gaps:18/144 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VSCCLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDP--HPKYNFAYDV 71
            |:..|...:|..:|:|.....|.|.. |.|  |:....|.:|.        :|  :|||:|.|.:
  Fly     5 VAIALLFAAAQAVPIELGHYAPALVH-HAP--VLSHAVHAVHA--------EPVAYPKYSFNYGI 58

  Fly    72 QDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAA 136
            :|..:||.|||.|.||||||:|:|||.:.||..|||.||||..||||||||:.    ...|::|.
  Fly    59 KDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKT----APSKIIAH 119

  Fly   137 APVQYHHAPAAAAA 150
            ||| .|.||..|.|
  Fly   120 APV-LHAAPVLAHA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 30/51 (59%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.