DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and CG34462

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:95/269 - (35%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKLVALVSCCLAAVSAGL-IPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPHPKYN 66
            |.:..|::...||:|..| ..:|.::| |::....:...|.....||  |:|...        |:
  Fly    10 FFVFVLITKVYAALSNPLSSKIEVYNQ-PEVTPEKERAKVRNYFVHE--PYGPNT--------YS 63

  Fly    67 FAYDVQDALSGDSKSQVESR--DGDVVQGEYSLDDADGFRRTVKYTADSVNGFNA---------- 119
            |.|::.|..:.:|:.:.|.|  :|. :||.|.....||.....||.|....|::|          
  Fly    64 FGYEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFKAGDE 127

  Fly   120 -------------VVHR-----------EPLAHVHHKV------VAAAPVQYHHAPAAAAAVIKS 154
                         :|.|           :|.:|::..|      ||....|.|........|.|.
  Fly   128 KVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKD 192

  Fly   155 YASPSQAYV----APTYAAPA------------YTAPA-YATHQA--EQPQEREHQQHHYASYES 200
            ...|:...|    .||...|.            :..|| ..|.:|  .:||:.|..::|.|...:
  Fly   193 VLKPAVLDVIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATTAEPQKTESSKYHRAQSNN 257

  Fly   201 PAHAQAAHE 209
            ...||...|
  Fly   258 AEKAQQVEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 16/53 (30%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.