DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:223 Identity:99/223 - (44%)
Similarity:121/223 - (54%) Gaps:62/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQ--------AHQP----QHVIYQKQHEIHPHG 53
            ||||.|..:: .:|..|||..|:..    ||:|.        ||.|    |.|:.:...|.    
  Fly     1 MAFKFVFALA-FVAVASAGYAPIAA----PQVYHAAPAVATYAHAPVAVAQKVVVKAAEEY---- 56

  Fly    54 HEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFN 118
                  ||||:|.|:|.|.|.|:||:|.|||.||||||:|||||.||||::|.|:||||.:||||
  Fly    57 ------DPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFN 115

  Fly   119 AVVHREPLAHVHHKVVA--------AAPVQYHHAPA----AAAAVIKS------YASPSQA---- 161
            |||:||||.    |.||        ||||..:.|||    ||.||:|:      ||:|:..    
  Fly   116 AVVNREPLV----KAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVA 176

  Fly   162 ----YVAP----TYAAPA-YTAPAYATH 180
                |.||    |||||. |.|||.|.|
  Fly   177 PVAHYAAPAAYATYAAPTHYAAPAVAYH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 34/51 (67%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.