DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:256 Identity:109/256 - (42%)
Similarity:132/256 - (51%) Gaps:75/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQ--------AHQP----QHVIYQKQHEIHPHG 53
            ||||.|..:: .:|..|||..|:..    ||:|.        ||.|    |.|:.:...|.    
  Fly     1 MAFKFVFALA-FVAVASAGYAPIAA----PQVYHAAPAVATYAHAPVAVAQKVVVKAAEEY---- 56

  Fly    54 HEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFN 118
                  ||||:|.|:|.|.|.|:||:|.|||.||||||:|||||.||||::|||:||||.:||||
  Fly    57 ------DPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFN 115

  Fly   119 AVVHREPLAHVHHKVVA--------AAPVQYHHAPA----AAAAVIKSYASPSQAYVAPT----- 166
            |||:||||.    |.||        ||||..:.|||    ||.||:|:.| |...|.||.     
  Fly   116 AVVNREPLV----KAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVA-PVAHYAAPAVVKTV 175

  Fly   167 -----YAAPAYTAPAYATHQAEQPQEREHQQHH------YASYESPAHAQAAHEGHEYYHH 216
                 |||||    ||||:.|  |.......|:      |.||.:||.|         |||
  Fly   176 APVAHYAAPA----AYATYAA--PTHYAAPAHYAAPAATYTSYSAPAVA---------YHH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 35/51 (69%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440143
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.