DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Ccp84Ad

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:211 Identity:105/211 - (49%)
Similarity:126/211 - (59%) Gaps:44/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPD-----D 60
            ||||.:||.: .:||.|||::||:      |:|.| .|....|.:......|...|...     |
  Fly     1 MAFKFIALFA-LIAAASAGVLPVQ------QVYHA-APAVATYAQAPVAVAHAQPVLAKAAEEYD 57

  Fly    61 PHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREP 125
            |||:|.:||||||:||||||||||.||||||:|||||.||||::|||:||||.:|||||||:|||
  Fly    58 PHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREP 122

  Fly   126 LAHVHHKVVA--------AAPVQYHHAPA----AAAAVIKSYASPSQAYVAPT----------YA 168
            |.    |.||        ||||.::.|||    ||.||:|:.| |...|.||.          ||
  Fly   123 LV----KAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVA-PVAHYAAPAVVKTVAPVAHYA 182

  Fly   169 APA----YTAPAYATH 180
            |||    |.|||.|.|
  Fly   183 APATYTSYAAPAVAYH 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 40/51 (78%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.