DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Ccp84Af

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:154 Identity:79/154 - (51%)
Similarity:97/154 - (62%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPD-----D 60
            ||||..|::: .::|.|||::||:      |:|.| .|....|.:......|...|...     |
  Fly     1 MAFKFFAVLA-LISAASAGVLPVQ------QVYHA-APAVATYAQAPVAVAHAQPVLTKATEEYD 57

  Fly    61 PHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREP 125
            |||:|.|||||||:||||||||||.||||||.|||||.|:||::|.|:||:|.||||||||:|.|
  Fly    58 PHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP 122

  Fly   126 LAHVHHKVVAAAPVQYHHAPAAAA 149
            |.||...|...|||....||...|
  Fly   123 LDHVKTVVKTVAPVAVAAAPIPVA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 39/51 (76%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440144
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.