DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:189 Identity:87/189 - (46%)
Similarity:107/189 - (56%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPHPKY 65
            ||||...|.:.|:|..|||:||            |..|...:.|.         |.|  ||||:|
  Fly     1 MAFKFTILFAACIAVASAGIIP------------AAAPLAAVAQV---------EEY--DPHPQY 42

  Fly    66 NFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVH 130
            .:.|||:||:|||||:|||:|:||||||:|||:||||:||.|.||||.:|||||||.||||.   
  Fly    43 TYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLV--- 104

  Fly   131 HKVVAAAPVQYHHAP------AAAAAVIKS-------YASPSQAYVAPTYAAPAYTAPA 176
             ..|||||.....||      |.||.|:::       .|:|:....|...|..||.|||
  Fly   105 -AAVAAAPAAVVAAPAPVVRAAVAAPVVRAAPLTTTYAAAPAPLAYAAAPAPLAYAAPA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 36/51 (71%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440155
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.