DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:228 Identity:51/228 - (22%)
Similarity:76/228 - (33%) Gaps:74/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VSCCLAAVSAGLI---PVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPHPKYNFAYD 70
            ::.||...:.||.   |..::...|......|..|   |.:|..:.:|:..      |.|     
  Fly     4 LNLCLICTTIGLAVGSPTLEYGPPPTSDTISQYHH---QDEHGQYAYGYMA------PLY----- 54

  Fly    71 VQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFN----------------- 118
                    ||.:..:.|| |::|.:|..||:|..:||.|.||: .||:                 
  Fly    55 --------SKHETRTVDG-VIRGTFSHIDANGETQTVDYVADA-EGFHVTSNLPNQQANQETPEV 109

  Fly   119 AVVHREPL-AHVHHKV-----VAAAPVQYHHAPAAAAAVI-------------------KSYASP 158
            |.:..:.| ||...|:     .:..|......|..|||.:                   |....|
  Fly   110 AALRTQHLEAHNQAKLRLAGDYSVGPQPVRDTPEVAAAKVAFFKRFEAEKLRNKLLAEKKVLVIP 174

  Fly   159 SQAYVA----PTYA-APAYTAPAYATHQAEQPQ 186
            :...:|    |.|. .|..|...|..|...|.|
  Fly   175 NPTPIAVRSQPIYVYQPTTTGFVYNYHTKTQAQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 16/51 (31%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.