DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:75 Identity:21/75 - (28%)
Similarity:32/75 - (42%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QKQHEIHPHGHEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDGDV-VQGEYSLDDADGFRRTV 107
            :.|.|...:.:|:.||.   .|::.|...:.:...     ||..|.| ..|..|....||....:
  Fly    21 ESQAETTKYRNEIKPDG---SYSWEYGTSNGIDAQ-----ESGVGGVQAAGSVSYAAPDGTPIQL 77

  Fly   108 KYTADSVNGF 117
            :||||. ||:
  Fly    78 EYTADE-NGY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 15/52 (29%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 15/52 (29%)

Return to query results.
Submit another query.