DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr66D

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:192 Identity:61/192 - (31%)
Similarity:81/192 - (42%) Gaps:52/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YQAHQPQHVIYQK----------------------------QHEI---HPHGHEVYPDDPHPKYN 66
            ||.:|||...|:.                            ||::   ..:..|.| ||.:..|.
  Fly    96 YQQYQPQQAAYRPPAQAAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNEEEEY-DDQNSSYQ 159

  Fly    67 FAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHH 131
            |.:||:|....:.:::.|.|||.|::|.||:.|:|||.||||||||...||.|.|.|||...|..
  Fly   160 FGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVK 224

  Fly   132 KVVAAAPVQYHHAPAAAAAVIKSYAS-PS-QAYVAPTYAAPAYTAPAYATHQAEQPQEREHQ 191
            ......|.|...|....|.  :.|:| || |.|                .||.:|.|.:.||
  Fly   225 IPTPPPPTQLLRAGGHKAQ--QEYSSGPSKQQY----------------QHQQQQQQPQYHQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 25/51 (49%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.