DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr66Cb

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster


Alignment Length:167 Identity:65/167 - (38%)
Similarity:82/167 - (49%) Gaps:30/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSC-CLAAV----------SAGLIPVEQHDQHP-QLYQAHQPQHVIYQKQH------ 47
            ||||.:...|. ||:..          |.|...:..|:..| ..|..||.:.:...::|      
  Fly     1 MAFKYLIFASALCLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQIERISLGEEHGHLEHA 65

  Fly    48 EIHPHGHEVYPDDPH------PKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRT 106
            |.|...||.:..|.|      |||.|.|.|.|..:||.|||.|:||||.|:|:|||.:.||..||
  Fly    66 EPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRT 130

  Fly   107 VKYTADSVNGFNAVVHREPLAHVHHKVVAAAPVQYHH 143
            |.||||..||||||||:....| ||:     .:..||
  Fly   131 VDYTADKHNGFNAVVHKTAPVH-HHE-----ELHEHH 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 30/51 (59%)
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453150
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.