DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:90 Identity:22/90 - (24%)
Similarity:32/90 - (35%) Gaps:22/90 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHV 129
            |.:.|...:.::|    |.....|....|..:....||....:.||||| ||:            
  Fly    41 YAYQYQTSNGIAG----QESGVGGYYASGSNAYYAPDGQLIQLTYTADS-NGY------------ 88

  Fly   130 HHKVVAAAPVQYHHAPAAAAAVIKS 154
             |...|..|.    .|...|:::||
  Fly    89 -HPAGAHLPT----PPPIPASILKS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 14/51 (27%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 14/51 (27%)

Return to query results.
Submit another query.