DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:180 Identity:36/180 - (20%)
Similarity:56/180 - (31%) Gaps:79/180 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EIHPHGHEVYPDDPHPKYNFAYDVQDALS----------GDSKSQVESRDGDVVQGEYSLDDADG 102
            ||....:|:..:|  ..||:.::..:.::          ....||..:.:|.::|          
  Fly    31 EIRSFVNELKQED--GIYNYQFETSNGIAQQEQGVGGYYASGSSQYYTPEGQLIQ---------- 83

  Fly   103 FRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAAAPVQYHHAPAAAAAVIKSYASPSQAYVAPTY 167
                :.||||. |||.......|..|         |:        ..|::||.            
  Fly    84 ----LTYTADE-NGFQPQGEHLPTPH---------PI--------PEAILKSL------------ 114

  Fly   168 AAPAYTAPAYATHQAEQPQEREHQQHHYASYESPAHAQAAHEGHEYYHHQ 217
                    .|..:..|:..|.||..||             |:.||  |||
  Fly   115 --------EYNRNHPEEDGEYEHHDHH-------------HDHHE--HHQ 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 11/61 (18%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 11/61 (18%)

Return to query results.
Submit another query.