DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr64Ab

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:149 Identity:72/149 - (48%)
Similarity:84/149 - (56%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCL-AAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPHPK 64
            ||...:.|:.|.| ||:...|:|            |..|..|         |...||   ||||:
  Fly     1 MALIKITLICCALIAAIECALLP------------AAVPVGV---------PLNTEV---DPHPQ 41

  Fly    65 YNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHV 129
            |.|||:|||||:||||||.|.||||||:|.||:.||||..|||.||||.:|||||||.|.|:.  
  Fly    42 YAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVP-- 104

  Fly   130 HHKVVAAAPVQYHHAPAAA 148
                |||.|:.   ||.||
  Fly   105 ----VAARPLV---APVAA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 37/51 (73%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.