DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:214 Identity:87/214 - (40%)
Similarity:109/214 - (50%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKLVALVSCCLAAVSAGLIP-----VEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDD 60
            ||.||:.::|..:|..||.::|     :..:..:|.|.:...|   :..|     ..|.|.|  |
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAP---LVAK-----VAGPEPY--D 55

  Fly    61 PHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREP 125
            |:|:|.|:|||.|..:||.|||.|:|.||||||.|||.:|||.||.|:||||.|:||||||.||.
  Fly    56 PNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREG 120

  Fly   126 LAHVHHKVVAAAPVQYHHAPAAAAAVIKSYASPSQAYVAPTYA---APAYTAPAYATHQAEQPQE 187
            ..     |.|.|||....|||...     :|||..|.| |.|.   ||||  ||.|         
  Fly   121 AV-----VKAVAPVAKVLAPAPLL-----HASPLVAKV-PAYGPALAPAY--PALA--------- 163

  Fly   188 REHQQHHYASYESPAHAQA 206
                 |.|....:||:..|
  Fly   164 -----HGYGPALAPAYGPA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 33/51 (65%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.