DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr56F

DIOPT Version :10

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:65 Identity:27/65 - (41%)
Similarity:38/65 - (58%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAH 128
            ||.|.|||||..||:....:||||||:..|.|.:...||.::.|:|.||. ||:...:..|.:.:
  Fly   127 KYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYRPTIRYEQVGN 190

  Fly   129  128
              Fly   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 24/51 (47%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 24/51 (47%)

Return to query results.
Submit another query.