DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:80 Identity:19/80 - (23%)
Similarity:32/80 - (40%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YNFAYDVQDALSGDSKSQVE---SRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPL 126
            |::.::.::.:.|:...::|   ..:|...:|.|.....||....|.|.||. |||        :
  Fly   173 YHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADD-NGF--------V 228

  Fly   127 AHVHHKVVAAAPVQY 141
            ....|...|..|..|
  Fly   229 PSAAHLPTAPPPPPY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 13/54 (24%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.