DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ac and Cpr23B

DIOPT Version :9

Sequence 1:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:191 Identity:70/191 - (36%)
Similarity:95/191 - (49%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IPVEQHDQHPQLY---QAHQPQHVIYQKQHE-------IHPHGH-EVYPDDPHPKYNFAYDVQDA 74
            :||.:|:|:.::.   |..|.|..:..:|.|       :..|.. ||:|.   ..|:|.|.|.||
  Fly   105 LPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPP---ASYSFNYAVNDA 166

  Fly    75 LSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAAAPV 139
            .:||.|...|:|||.||:|.|||.|.||::|||.||||.|:||||||:|.|.| :...||..|.|
  Fly   167 STGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVPYA-LKAVVVPVAQV 230

  Fly   140 Q-----------------YHHAPAAAAA---VI----KSYASPSQAYVAPTYAAPAY-TAP 175
            .                 ...:.|||.|   |:    .|..|.|.:.|:.|:|..:| .||
  Fly   231 AQPTPFVARDERSKSVDVIRSSGAAAGASENVLSGSGSSSGSVSGSGVSDTFAEDSYANAP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 30/51 (59%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.