DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:105 Identity:31/105 - (29%)
Similarity:46/105 - (43%) Gaps:12/105 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLSGDSKSQVE----ERDGDVVRGEY 92
            ||.:|.|..|.|..:|.:.::..:..|. .:||.::..|..:..:..|:.    |.:...|.|.|
  Fly     8 VALFAVALAAPAAEEPTIVRSESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTENEAISVSGSY 71

  Fly    93 SLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPV 132
            ..|..||....|.|.||. |||      :|....:.||||
  Fly    72 RFIADDGQTYQVNYIADK-NGF------QPEGAHLPVAPV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 16/55 (29%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.