DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr65Ax2

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_652660.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:135 Identity:39/135 - (28%)
Similarity:49/135 - (36%) Gaps:41/135 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KF-IALFALIAAASAGVLPVQQVYHAAPAVATY-AQAPVAVAHAQPVLAKAAEEYDPHPQYKYAY 66
            || |.||||.|.|.           |||.|... :.:.|.:                 ..|.||.
  Fly     2 KFAIVLFALFAVAL-----------AAPTVEVLRSDSNVGI-----------------DNYSYAV 38

  Fly    67 DVQDSLS----GDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAV 127
            :..|..|    |..|:...|.:.....|.:|.:..||...||.|.||. |||      :|....:
  Fly    39 ETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADE-NGF------QPQGAHL 96

  Fly   128 AVAPV 132
            .||||
  Fly    97 PVAPV 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 18/55 (33%)
Cpr65Ax2NP_652660.1 Chitin_bind_4 34..89 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.