DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and CG34461

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster


Alignment Length:151 Identity:70/151 - (46%)
Similarity:94/151 - (62%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIALFALIAAASAGVLPVQQVYHAAPAVATYAQA---PVAVAHAQPVLAKAAEEYDPHPQYKYAY 66
            |:|:..|.|||.|  :|: ::.|.|||:..:|..   .|...||:||         .:|:|.:.|
  Fly     4 FVAIALLFAAAQA--VPI-ELGHYAPALVHHAPVLSHAVHAVHAEPV---------AYPKYSFNY 56

  Fly    67 DVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAP 131
            .::|..:||.|||.||||||||:|:|||::.||..|||.||||..|||||||::....|.:|.||
  Fly    57 GIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPSKIIAHAP 121

  Fly   132 VVKTVAAPV-AHYAAPAVAHY 151
            |:.  |||| ||  ||.:.||
  Fly   122 VLH--AAPVLAH--APLLHHY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.