DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and CG34462

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:120 Identity:28/120 - (23%)
Similarity:51/120 - (42%) Gaps:15/120 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVA--VAHAQPVLAKAAEEYDPHPQYKYA 65
            |.|:.:..:.||.|..:....:||:.........:|.|.  ..|         |.|.|: .|.:.
  Fly    11 FVFVLITKVYAALSNPLSSKIEVYNQPEVTPEKERAKVRNYFVH---------EPYGPN-TYSFG 65

  Fly    66 YDVQDSLSGDSKSQVEER--DGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV 118
            |::.|..:.:|:.:.|:|  :|. ::|.|.....||.....:|.|....|::|.:
  Fly    66 YEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 13/53 (25%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 13/51 (25%)

Return to query results.
Submit another query.