DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr92F

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:235 Identity:68/235 - (28%)
Similarity:81/235 - (34%) Gaps:70/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQ 69
            |||...||:..||.       :|.  ||:|..|                 ..||| .:.|:|...
  Fly     5 FIAAALLISTVSAS-------WHG--AVSTQYQ-----------------HLDPH-SHTYSYGYA 42

  Fly    70 DSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPVVK 134
            |..|  .|.:....|| ...|.||.:|..|:.::|.|||||.:|||||....|....|..|||..
  Fly    43 DPNS--QKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYA 104

  Fly   135 T-----VAAPVAH--YAAPAVAHYAAPAVVKTV--APVAHYAAPAVVKTVA-------------- 176
            .     ..||.||  ...|.:.|...|.....|  |..||.||.|.....|              
  Fly   105 AAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGGG 169

  Fly   177 ---------PVAHYAAP--------ATYTSYAAPAVAYHH 199
                     |:.|...|        |....|||.|.|..|
  Fly   170 WAYGQAAHVPLTHGGVPVDTPDVQAAKAEHYAAHAKALGH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 18/51 (35%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.