DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr92F

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:235 Identity:68/235 - (28%)
Similarity:81/235 - (34%) Gaps:70/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQ 69
            |||...||:..||.       :|.  ||:|..|                 ..||| .:.|:|...
  Fly     5 FIAAALLISTVSAS-------WHG--AVSTQYQ-----------------HLDPH-SHTYSYGYA 42

  Fly    70 DSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPVVK 134
            |..|  .|.:....|| ...|.||.:|..|:.::|.|||||.:|||||....|....|..|||..
  Fly    43 DPNS--QKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYA 104

  Fly   135 T-----VAAPVAH--YAAPAVAHYAAPAVVKTV--APVAHYAAPAVVKTVA-------------- 176
            .     ..||.||  ...|.:.|...|.....|  |..||.||.|.....|              
  Fly   105 AAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGGG 169

  Fly   177 ---------PVAHYAAP--------ATYTSYAAPAVAYHH 199
                     |:.|...|        |....|||.|.|..|
  Fly   170 WAYGQAAHVPLTHGGVPVDTPDVQAAKAEHYAAHAKALGH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 18/51 (35%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 18/49 (37%)

Return to query results.
Submit another query.