DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr92A

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:248 Identity:98/248 - (39%)
Similarity:117/248 - (47%) Gaps:57/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFIALFALIAAASAGVL---PVQQVYHAAPA-------VATYA--QAPVAVAHAQPVLAKAAEEY 56
            |...|.|::..|.|||:   |    |:..||       ...||  ..|:...:..|..| |.|.|
  Fly     3 KISLLSAMLGIAYAGVIGPGP----YYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPA-APEPY 62

  Fly    57 DPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121
            ||.|:|.:.||:||..:||.|||.|.|.||||:|.||::|.||.||||.|||||.:||||||.:|
  Fly    63 DPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKE 127

  Fly   122 PLV-KAVA-VAPVVKTVAAPV-AHY----------------------------AAPAVAHYAAPA 155
            ||. ||.| :||||....||| |||                            .|||.|...|||
  Fly   128 PLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPAPA 192

  Fly   156 ---------VVKTVAPVAHYAAPAVVKTVAPVAHYAAPATYTSYAAPAVAYHH 199
                     |...|.|.||:.|.......:|.|||.||....:...|...|||
  Fly   193 PAPAPVSVPVATPVLPSAHFHAAYPALAHSPYAHYPAPGPAPAPVEPHAYYHH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 31/51 (61%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 19/60 (32%)
Chitin_bind_4 68..120 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.