DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Ccp84Af

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:181 Identity:128/181 - (70%)
Similarity:136/181 - (75%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYA 65
            |||||.|:.|||:||||||||||||||||||||||||||||||||||||.||.||||||||||:|
  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFA 65

  Fly    66 YDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVA 130
            |||||||||||||||||||||||.|||||||:|||||.||||:||:|||||||||.||       
  Fly    66 YDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPL------- 123

  Fly   131 PVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHY 181
            ..|||                    |||||||||..|||      .|||::
  Fly   124 DHVKT--------------------VVKTVAPVAVAAAP------IPVAYH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 45/51 (88%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 45/51 (88%)

Return to query results.
Submit another query.