DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:212 Identity:112/212 - (52%)
Similarity:130/212 - (61%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFIALF-ALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKY 64
            |||||..|| |.||.||||::|              |.||:| |.||      .|||||||||.|
  Fly     1 MAFKFTILFAACIAVASAGIIP--------------AAAPLA-AVAQ------VEEYDPHPQYTY 44

  Fly    65 AYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAV 129
            .|||:|::|||||:|||.|:||||:|:|||.|||||:|.|.|||||||||||||.|||||.|||.
  Fly    45 GYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAA 109

  Fly   130 ---------APVVK-TVAAPVAHYAAPAVAHYAAP----AVVKTVAPVAHYAAPAVVKTVAPVAH 180
                     ||||: .|||||.. |||....|||.    |.....||:| |||||.|...||:..
  Fly   110 APAAVVAAPAPVVRAAVAAPVVR-AAPLTTTYAAAPAPLAYAAAPAPLA-YAAPAPVVKAAPLVA 172

  Fly   181 YAAPATYTSYAAPAVAY 197
            .......|.:|:|.::|
  Fly   173 AGPAIVKTQFASPLISY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 37/51 (73%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440157
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.