DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:98 Identity:23/98 - (23%)
Similarity:36/98 - (36%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121
            |....|:||::..:.:.......|     :.:.|..|.|..:|...::.|.||. |||      :
  Fly    37 DAEGNYQYAFETSNGIQAQEAGNV-----NGISGSSSYISPEGVPISLTYVADE-NGF------Q 89

  Fly   122 PLVKAVAVAPVVKTVAAPVAHYAAPAVAHYAAP 154
            |....:..||.:.........|.|   ||...|
  Fly    90 PQGDHLPTAPPIPEAILRALEYIA---AHPPQP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 12/51 (24%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 12/51 (24%)

Return to query results.
Submit another query.