DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr78Cb

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:66 Identity:16/66 - (24%)
Similarity:25/66 - (37%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121
            |....:|||:...:.:...:.....|     ..|.||....:|.....:|.||.: ||:.|....
  Fly    50 DDEGVFKYAFKTSNGIDVQAAGSPLE-----TIGIYSYTSPEGVPIETRYIADEL-GFHVVGRHL 108

  Fly   122 P 122
            |
  Fly   109 P 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 11/51 (22%)
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 11/51 (22%)

Return to query results.
Submit another query.