DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:172 Identity:91/172 - (52%)
Similarity:103/172 - (59%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEE-YDPHPQYKYA 65
            |..|.|..|.:||..|..:........||..|..| ||||...|.||.|..|.| .|.|||||:|
  Fly    86 AAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLA-APVAAPLAAPVAAPIATEIVDAHPQYKFA 149

  Fly    66 YDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVA 130
            |||||:|:||||:|.|.||||||||.||||:.||.:|.|.|.||.||||||||.::..|....||
  Fly   150 YDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVPVAVAPVA 214

  Fly   131 PVV-KTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAV 171
            ||: |||||||    ||.||...||...||:      |||.|
  Fly   215 PVLAKTVAAPV----APVVAAAPAPVFAKTL------AAPIV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 36/51 (71%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.