DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr50Cb

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:165 Identity:44/165 - (26%)
Similarity:60/165 - (36%) Gaps:61/165 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFK-FIALFALIAAASAGVLPVQQVYHAAPAVATYAQ-APVAVAHAQPVLAKAAEEYD------ 57
            |:|| |:.|...:||.||               ..||| ||.:.|:..|  .|...:|.      
  Fly     2 MSFKSFVLLSLSLAAISA---------------YAYAQIAPGSNAYLPP--TKNGYDYSEPKTPF 49

  Fly    58 ------------PHP------------------------QYKYAYDVQDSLSGDSKSQVEERDGD 86
                        |.|                        .|.:.|.|||..:.:..:.....|||
  Fly    50 KPGPPGRPAAPGPRPPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGD 114

  Fly    87 VVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121
            ||.|||.:...||..:.|:||||...|::|.|:.|
  Fly   115 VVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 20/51 (39%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.