DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr50Ca

DIOPT Version :9

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:171 Identity:47/171 - (27%)
Similarity:69/171 - (40%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYD-VQDSLSGDSKSQVEERDGDVVRGEYSLIDAD 98
            |.:|||...|   |..|.:....||...|.... ::|.|.|  |:.|:     .:..:.|  |.:
  Fly   324 YKEAPVNSGH---VKTKKSLSTLPHEVQKVISQLMKDGLGG--KAYVK-----YLPAQKS--DYE 376

  Fly    99 GYK-RTVQYTADPINGFNAVVNREPLVKAVAVAPV-VKTVAAPVA---------HYAAPAVAHYA 152
            .|| :::.|...|:..:...:|: |...|.:.:|| |.....||.         ||||      .
  Fly   377 HYKAKSLSYGGKPLVNYVKYINK-PAEPAASPSPVQVHIQPVPVVEQLRYVYKPHYAA------V 434

  Fly   153 APAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPATYTSYAAP 193
            ||.:.:   |:....|||....|..|.|     |||:..||
  Fly   435 APTIAQ---PIVVQEAPAPTAAVEEVHH-----TYTAELAP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 12/53 (23%)
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.