DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:162 Identity:40/162 - (24%)
Similarity:54/162 - (33%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKA-------------AEEYDPHPQ-YKY 64
            |...|...|.....|.|.......||.|:|.....|.|.             .:|.|.... |.|
  Fly   111 AGGGGAAVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHY 175

  Fly    65 AYDVQDSLSGDSKSQVE---ERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKA 126
            .::.::.:.|:...::|   |.:|...:|.|.....||....|.|.||. |||         |.:
  Fly   176 LWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADD-NGF---------VPS 230

  Fly   127 VAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVK 158
            .|..|    .|.|...|....:|...|.|..|
  Fly   231 AAHLP----TAPPPPPYVEKLLAFLEANAKTK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 15/54 (28%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.