DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and LOC3290077

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_556644.2 Gene:LOC3290077 / 3290077 VectorBaseID:AGAMI1_006388 Length:168 Species:Anopheles gambiae


Alignment Length:65 Identity:36/65 - (55%)
Similarity:47/65 - (72%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV 118
            ::|..:|:||:.|.|:|..:||.|||.|.||||||:|||:|.:.||..|.|:|.||..|||.|||
Mosquito    61 KDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTLDEPDGSTRIVKYHADSKNGFEAVV 125

  Fly   119  118
            Mosquito   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)
LOC3290077XP_556644.2 None

Return to query results.
Submit another query.